Kayhar

The Mershael are a nautical people, with ships plying all the seaways of Faelon. Kayhar form units of elite marines aboard these ships. They employ their versatile kasari weapons to restrict their enemies’ movements to assist in delivering a killing strike with the heavy left-hand blade, and slice through enemy rigging during boarding actions.   https://www.dgsgames.com/kayhar/  

Kayhar


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d10Kasari d8 Hinder Quick Strike**552d10Dodge [1], Quick, Confine, Amphibious, Veteran [Sergeant [Seafarer, Deck Gunner], 2], AGL d1228

Hinder

(hin) A target hit by this weapon takes an AGL test 5 and if it fails is -1dl MAR.

Quick Strike

(qs) An attack with this weapon is treated as +1dl DISC for combat sequence purposes unless the target has a higher DISC. You are also treated as having the Counterattack talent for attacks with this weapon only.

Dodge


TalentEffectPre-reqsPathsCost
Dodge [X]You may attempt to Dodge X number of melee or ranged attacks per turn. To Dodge, make an AGL test and the result is your DEF for that attack. If the result is less than your DEF, your DEF is used instead of the result of the roll. If the roll is a Tarch, your DEF is 1 for that attack. A successful Dodge test results in the attack becoming a miss. A single attack may not be both Parried and Dodged. A single attack may not be Dodged more than once. Dodge may make use of Split Dice. Splitting a Dodge die is still a single Dodge. A Dodge test is treated as an Opposed test with you employing Dodge as the opposer. [R]-MX

Quick

You ignore the first penalty to DEF from Piling On.

Confine


TalentEffectPre-regsPathsCost
ConfineEnemies in contact with you cannot employ Post Combat Abilities.MAR d10Blade1

Amphibious


TalentEffectPre-reqsPathsCost
AmphibiousYou treat Deep Water and Very Rough Watery terrain as Rough, and treat other Watery terrain as if Easy for movement. You are Concealed in Watery terrain.W0.5

Veteran

Veteran [Upgrade, Cost]. You may add [Cost] to gain [Upgrade]. A Veteran upgrade may be taken at any time before or after a game, but once taken cannot be altered.

Sergeant


TalentEffectPre-reqsPathsCost
Sergeant [Follower Type]Only a friend of the named Follower type may benefit from this talent. A non-Feral Follower within 6” may use your model’s DISC for all DISC tests. This includes the Shoot Them! talent.DISC d8BHMW2

Comments

Please Login in order to comment!
Powered by World Anvil