Rustler

A man who understands horses and has a good reputation for obtaining them is valuable to a bandit leader. Erolis always keeps a few rustlers in her crew to collect the best horses available and maintain them, critical to bandits who may need a fast escape.   One of the dark and evil men within the bandit organization. He is quick to provide, “a kiss of his whip” to anyone in his way.   https://www.dgsgames.com/rustler/  

Rustler


SPDMARMWRARRWDEFAVLPDISCSPECIALCOST
7d8Broadsword d8,
Whip d4 Entangle Quick Strike
**431d6*12

Entangle

(ent) If a target on the same or smaller base is hit by a weapon with this ability, the target must take an AGL test 5. If it fails, the target is -2 DEF. If the AGL test is failed by 4+, the target is Restrained instead. If the attack is a Critical, instead of auto-spiking damage, increase the TN of the AGL test by 2 for each level of Crit. Flame

Quick Strike

(qs) An attack with this weapon is treated as +1dl DISC for combat sequence purposes unless the target has a higher DISC. You are also treated as having the Counterattack talent for attacks with this weapon only.

Comments

Please Login in order to comment!
Powered by World Anvil